PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122364001
Common NameGSBRNA2T00122364001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 299aa    MW: 32912.2 Da    PI: 9.0061
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122364001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.64.3e-33163219158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQyq+Il+RRq+Rak+e e kl +ksrkpylheSRh+hA+rRpRg+gGrF
  GSBRNA2T00122364001 163 QEPVYVNAKQYQAILRRRQARAKAELEMKL-IKSRKPYLHESRHQHAMRRPRGTGGRF 219
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.2E-36161222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.414162222IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.0E-29164219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-24165187IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860167187IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.6E-24196219IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MHSKKPDGGN QIVSEVVHHH TSSSSINSLN PWQRAAAACN ASSLVEEAGD KSIALENQNN  60
WESTNGSKSP SNRDDNGNKE SPQVTTSPQE SAGDYSEKSQ ELVHVGVTGP PHPQLVSHTV  120
GWASSNPYQD PYYAGMMGAY PMAYVPYGGM PHSRMPLPPE VAQEPVYVNA KQYQAILRRR  180
QARAKAELEM KLIKSRKPYL HESRHQHAMR RPRGTGGRFA KKTNTEASQP KPGEKNNATQ  240
SPTSSHSDQP EAWNDECRKQ SEEMQSSASK RREEADCSGQ QWNSISSNHT SQARLAIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19163219258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.21780.0bud| flower| leaf| microspore| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122364001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBNU338840.0U33884.1 Brassica napus clone bncbf-b1 CCAAT-binding factor B subunit homolog mRNA, complete cds.
GenBankBNU338850.0U33885.1 Brassica napus clone bncbf-b2 CCAAT-binding factor B subunit homolog mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587298.10.0PREDICTED: nuclear transcription factor Y subunit A-9 isoform X1
RefseqXP_013697365.10.0PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X1
SwissprotQ945M91e-147NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A078F3V20.0A0A078F3V2_BRANA; BnaC05g31370D protein
TrEMBLA0A0D3CHV50.0A0A0D3CHV5_BRAOL; Uncharacterized protein
STRINGBra031242.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132681829
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-142nuclear factor Y, subunit A9
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]